TPT
Total:
$0.00
Selected
Subjects

Subjects

Arts & Music
English Language Arts
Foreign Language
Holidays/Seasonal
Math
Science
Social Studies - History
Specialty
For All Subject Areas
9,967 results

Phonics flash cards for homeschool

Preview of Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

You understand the importance of sight words and decoding practice! These high frequency word flashcards help children read sight words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports learning new sight words within a sentence. What is included?400 sight word card
Preview of ABC Big Flashcards w/ Movements

ABC Big Flashcards w/ Movements

Created by
Lisaelaine
ABC Big Flashcards with optional backside with letter, movement explanation, and keyword. A-Z, short and long vowel sounds, both sounds for c,g,s,x and all 4 sounds of y included. **Letters on top!A-apple,apronB-board, ball (2 options)C-cat, circle (both sounds of c)D-dogE-edge, eagleF-front teeth, fish (2 options)G-guitar, giraffe (both sounds of g)H- heartI- igloo, iceJ- jacketK- keyL- lionM- monkey, meal (2 options)N-noseO-octopus, openP- pig, push (2 options)Q-queenR- rainbowS- snake, dogs (
Preview of Phonics Decoding Drills Sheets Practice Worksheets One Syllable Words 1st Grade

Phonics Decoding Drills Sheets Practice Worksheets One Syllable Words 1st Grade

Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. Decoding Drills provide students the opportunity to practice their newly learned skills in a fun and engaging format.The use of nonsense words in Decoding Drills helps students build speed and automaticity when reading. The use of real words in Decoding Drills provides students exposure to words with that skill. This means that this practice will improve student fluency when reading.
Preview of Flashcards w Movements BUNDLE

Flashcards w Movements BUNDLE

Created by
Lisaelaine
A-Z with multiple sounds and long vowelsDigraphsBeginning BlendsVowel teams and Diphthongs
Preview of Digraph Big Flashcards w Movements

Digraph Big Flashcards w Movements

Created by
Lisaelaine
Digraph Big Flashcards with backside that includes digraph, sound(s), movement explanation, and keyword. **Letters on top!Included:ckshch (2 picture options for /ch/) Card for just /ch/ and card for /ch/, /sh/ and /k/th- voiced and unvoicedwhphngqu
Preview of Decoding Sight Words "Interactive" Phonics Practice (w/audio) | Secret Stories

Decoding Sight Words "Interactive" Phonics Practice (w/audio) | Secret Stories

Created by
Secret Stories
Teach the READER, not the reading with Secret Stories® Decoding Sight Words "Interactive" Phonics Practice (w/audio)! The Secret Stories® embedded mnemonic sound images bring phonics sounds to life, making even the trickiest "so-called" sight words easily decodable! (Watch a video preview of this product here.)Did you know that for experienced readers, virtually EVERY word is a sight word? That’s because the definition of a sight word is ANY word that is recognized by sight, meaning that it has
Preview of Alphabet MEGA BUNDLE Letter of the Week - Phonics, Tracing, Crafts - 1600 pages

Alphabet MEGA BUNDLE Letter of the Week - Phonics, Tracing, Crafts - 1600 pages

Created by
KidSparkz
Alphabet bundle preschool - Letters for Little Learners - over 1600 pages – 26 BIG files, one for each letter of the alphabet. Low prep. Appropriate for pre-readers. Click HERE to try out the Letter A pack for FREE.This huge alphabet bundle includes: Recognition – Sounds - Tracing – Stamping – Flash cards - Puzzles – Cut/Paste – Wearables – MORE …Hands-on alphabet activities, centers, printables and learning games for your Preschool and Pre-K classroom for the entire year.These activities are
Preview of Two Letter Consonant Blends BIG Flashcards

Two Letter Consonant Blends BIG Flashcards

Created by
Lisaelaine
Two Letter Consonant Blends BIG Flashcards-22 Blends Flashcards Front: letters and keyword pictureBack: letters, sound, movement explanation, and keywordBlends included:blclflglplslbrcrdrfrgrprtrscskslsmsnspstswtw
Preview of Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

You understand the importance of sight word practice! These sight word flashcards help children read high frequency words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports new learning sight words within a sentence. What is included?250 sight word cards with decodab
Preview of Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Research shows that consistent review of previously taught skills and concepts is one of the BEST ways to ensure kids master foundational literacy skills. This resource includes EVERYTHING you need to implement an engaging, quick and effective review routine. These letter cards, high-frequency word cards, assessments and progress monitoring sheets are a perfect addition to your whole group, small group, or online learning instruction. This Resource Includes: Over 190 Printable Phoneme-Grapheme C
Preview of EDITABLE | HEART WORDS | SIGHT WORDS | Science of Reading

EDITABLE | HEART WORDS | SIGHT WORDS | Science of Reading

Are you looking for eye-catching high frequency ❤️ HEART WORD ❤️ cards for your sound/word wall that align with the Science of Reading?Then, this EDITABLE sight word resource is for you!The Science of Reading has brought about a change in the way educators approach high-frequency word instruction. It is now recognized that high-frequency words can be split into two categories: decodable (“Flash Words”) and irregular (“Heart Words”).Decodable Flash Words are expected to be read and spelled automa
Preview of CVC Rhyming Words Flashcards - Taskcards - Science of Reading RTI Phonics

CVC Rhyming Words Flashcards - Taskcards - Science of Reading RTI Phonics

Created by
Babbling Abby
WHAT'S INCLUDEDThis is a set of CVC RHYMING FLASHCARDS for you to use as a resource for instruction or reference tool for your students in preschool, kindergarten, first grade, and second grade. This set is also a part of money-saving BUNDLES Kindergarten in a Flash: ELA Edition & First Grade in a Flash: ELA Edition(please do not purchase if you own either). 115 RHYMING FLASHCARDS (color + black and white):This set includes CVC rhyming words. Each card includes the picture and word.SUGGESTIO
Preview of Secret Stories® Phonics Mystery Words w/Embedded Mnemonic Alphabet Cards

Secret Stories® Phonics Mystery Words w/Embedded Mnemonic Alphabet Cards

Created by
Secret Stories
***This product is intended for use WITH the Secret Stories® Flashcards***Excite your students and get their brains warmed up each morning with a Secret Stories® "mystery word" of the day! Students can try to crack the code to decode the word each morning. While this product can be used on its own to spell out CVC words, it is intended for use with the Secret Stories® 6x6 Flashcards (SOLD SEPARATELY) to build ANY word! For more ideas, search for "mystery words" in the Secret Facebook Group and d
Preview of Phonics Posters Cards BUNDLE - Blends, Digraphs, Vowels, Diphthongs & more!

Phonics Posters Cards BUNDLE - Blends, Digraphs, Vowels, Diphthongs & more!

Created by
Fairy Poppins
This Phonics Posters Bundle features beginning blends, ending blends, triple blends, beginning digraphs, ending digraphs, trigraphs, short vowels, long vowels, diphthongs, r controlled vowels and more!What I love about these posters!There are four designs to choose from (all newly updated) - plain borders, primary colors borders, bright borders or boho bordersThey are comprehensiveThere are cover pages included to keep your posters organizedSet 1 - Phonic Posters (Beginning Blends, Ending Blends
Preview of Phonics Sorts Pocket Chart Cards and Interactive Notebook Bundle

Phonics Sorts Pocket Chart Cards and Interactive Notebook Bundle

Created by
Brenda Tejeda
This includes phonics sorts in two formats: pocket chart cards and interactive notebook pages. Great for whole-group instruction as well as independent work during centers.Includes 115 phonics sorts to meet all of your students' levels!⭐️⭐⭐️⭐️⭐️ “I loved that it was not just a picture but gave some letter clues to go along with a picture. What is usually obvious to teachers is not always so for students. It was a big help!” -Karen B.(Parentheses shows number of sorts in each category):ANSWER KEY
Preview of Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency Check out the BUNDLE for a discount on ALL Decoding Drills resources!Short Vowel Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. ---------------------------------------------------------------------------------------------------------------------------- --DISTANCE LEARNING UPDATE - August 17, 2020--- ***I have now added DIGITAL versions of these Short Vowel Decoding Drills that have been formatted for us
Preview of Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Created by
Tammys Toolbox
These crazy phonics card games use the science of reading to help kids who need extra practice with nonsense word decoding strategies and syllable division rules. In Crazy Words, players must read single-syllable nonsense words to get rid of their cards. And in Crazy Nonsense Words 2 - Multisyllable Edition, players must use decoding skills to read multisyllable nonsense words correctly. Both games are great for providing practice with syllable division rules, syllable types, and decoding skills
Preview of FUN PHONICS Kindergarten Letter Keyword Sound Flash Cards

FUN PHONICS Kindergarten Letter Keyword Sound Flash Cards

Created by
ABC Girl
FUNDATIONS® Level K aligned Basic Keyword FlashcardsIncludes all keywords to align with Level K FUNDATIONS® Includes student sized flashcards for consonants, vowels, and digraphs--ready to print, cut and send home!ONLY CONSONANTS, VOWELS, and CONSONANT DIGRAPHS are included. Glued sounds, vowel digraphs and other advanced sounds are NOT included. If you are teaching KINDERGARTEN FUNDATIONS®, this file contains all of the sounds you need for the year. Both color and black and white versions are i
Preview of Schwa Sound Words Worksheets

Schwa Sound Words Worksheets

Created by
Kiddie Concepts
Schwa sound worksheets great for literacy centers and phonics practice! These worksheets focus on the spelling of words with the schwa sound and work great for supplemental support. Perfect activities for small skills group practice and pairs well with Science of Reading. Flash cards, GO FISH, memory game, write the schwa words can all be used as a group activity to introduce the schwa sound. Also, a poster in color and black and white to explain the schwa sound. This resource provides great
Preview of Phoneme Deletion and Substitution Flashcards - Taskcards - Science of Reading

Phoneme Deletion and Substitution Flashcards - Taskcards - Science of Reading

Created by
Babbling Abby
WHAT'S INCLUDEDThis is a set of PHONEME DELETION AND SUBSTITUTION FLASHCARDS/TASKCARDS for you to use as a resource for instruction or reference tool for your students in preschool, kindergarten, first grade, and second grade. This set is also a part of money-saving BUNDLES Kindergarten in a Flash: ELA Edition & First Grade in a Flash: ELA Edition(please do not purchase if you own either). 79 PHONEME DELETION AND SUBSTITUTION FLASHCARDS (color + black and white):This set includes flashcards/
Preview of R Controlled Vowels Big Flashcards w Movements

R Controlled Vowels Big Flashcards w Movements

Created by
Lisaelaine
R Controlled Vowels Big Flashcards with backside that includes r-controlled vowel, sound, movement explanation, and keyword.**Letters on top!Includes:er, ur, ir aror
Preview of Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

This Orton Gillingham bundle includes an Orton Gillingham scope and sequence, an editable Orton Gillingham lesson plan & a printable phoneme card deck. This bundle is the MUST-HAVE for any Orton Gillingham tutor!The phonics card deck includes:every single phoneme taught in the Orton Gillingham scope and sequence5 common prefixesthe most common 28 suffixes!!! Card Deck Layout:The front of the card shows the grapheme (letter) and the back shows order of frequency, alternate spellings, and wo
Preview of SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES CARD KINDERGARTEN 1ST 2ND

SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES CARD KINDERGARTEN 1ST 2ND

Created by
FREE YOUR HEART
SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES FOR ARTICULATION ⭐ CONSONANTS AND VOWEL VALLEY REFERENCE CARDS OR POSTERS WITH LOCKS FOR KINDERGARTEN AND 1ST / 2ND / 3RD GRADE Replace your word wall with this Science of Reading aligned student-friendly sound wall and facilitate your students' connection of phonemes to graphemes. This science of reading based sound wall will be the most beneficial tool for your students during phonics instruction and to guide them while reading and spelli
Preview of Alphabet Posters Real-Life Pictures!

Alphabet Posters Real-Life Pictures!

Alphabet Posters with real-life Pictures! Each poster includes correct letter formation with handwriting lines and a real-life photograph of the beginning sound of each picture. The poster pictures include the following:Aa- apple Bb - bearCc- catDd- dogEe -edge or eggFf- fishGg- goatHh- hammerIi- iglooJj- jellybeansKk - kiteLl -lionMm - monkeyNn - nestOo - octopusPp - pigQq - quiltRr - rainbowSs- sunflowrTt- tigerUu- Umbrella Vv- violinWw- watermelonXx - foxYy - yarnZz - zebraAlso included: sh,
Showing 1-24 of 9,967 results

Find Phonics resources | TPT

Learn more about phonics resources

You’ve probably heard that phonics is essential for students who are learning to read (and it is!), but you might be asking yourself: “What is it, exactly?” Phonics is a method for teaching children how to read and write in an alphabetic language. The goal is to help kids connect phonemes (the sounds in words) and graphemes (the symbols used to represent them). Ultimately, once students understand which sounds in spoken language correspond to which symbols (e.g., letters in the alphabet), they’ll be well on their way to learning how to read books and other written materials.

If you’re a teacher or parent looking for printable and digital resources to help your student learn phonics, but you’re not sure where to start, TPT has got you covered. We have a comprehensive collection of phonics resources, created by other teachers, that are designed to help with any learning need. With plenty of TPT resources at your fingertips, you can teach phonics to your students in no time at all.

Phonics resources to try

You can teach phonics and engage your students at the same time, with a variety of activities that cater to different learning styles and preferences. Here are a few examples of the different types of resources that you can find on TPT to help teach students about the relationships between letters and sounds.

Alphabet Scavenger Hunt

Hide letter cards around the room, say a sound aloud, and then have students search for the card that represents the sound.

Phonics Hopscotch

Take learning out onto the playground or at home with this easy-to-organize activity to help students build sound and letter recognition. Draw a hopscotch grid with letters in each square. Students jump on the letters while saying the corresponding sounds.

Silly Sentences

Have students create silly sentences using words that start with the same sound. An example could be: “Sally sells seashells by the shore.”

Anchor Charts

Post anchor charts around the room to help kids remember important rules or sounds being taught. (It could cover phonics concepts like the silent “e,” the long “o,” or a particular diphthong.)

Guess the Missing Letter or Sound

Use task cards or write a set of words on the board that share either a letter or sound. For example, at, ug, __ig. Ask students to find the missing letter or sound. Fill it in to show them the words bat, bug, and big.

These (and other!) activities can make learning phonics enjoyable and memorable for every student. Remember to adjust the activities based on the age and skill level of your students.

Frequently asked questions about teaching phonics

What types of phonics resources are available on TPT?

There are many different types of phonics resources sold by Sellers on TPT — from worksheets to interactive notebooks to units. Resources like these make great activities for students to practice their phonics skills.

How do I find phonics resources on TPT?

Educators can save time preparing phonics lessons with resources created by experienced teachers. Simply start a search for phonics resources on the TPT marketplace, and filter by grade level, price, and/or resource type to find materials that've been proven to work in classrooms like yours. No matter what you’re teaching, there are plenty of phonics lessons and activities sold by Sellers on TPT that are tailored to meet your students' skill levels.